PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G51870.2
Common NameAGL71
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MIKC_MADS
Protein Properties Length: 172aa    MW: 19903.1 Da    PI: 9.8609
Description AGAMOUS-like 71
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G51870.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.11.1e-28959151
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 k+ien + rqvtfskRr g++KKA+ELSvLCda+va i+fs++g+l+eyss
  AT5G51870.2  9 KKIENVTSRQVTFSKRRSGLFKKAHELSVLCDAQVAAIVFSQSGRLHEYSS 59
                 68***********************************************96 PP

2K-box53.97.9e-19851481174
        K-box  11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnelll 74 
                  e+  ++l+ e++++ k+i+ L+  +R+llG++L+s+s+ eLq++ +q+eksl+ +Rs+K + l 
  AT5G51870.2  85 ERYLQELKMEIDRMVKKIDLLEVHHRKLLGQGLDSCSVTELQEIDTQIEKSLRIVRSRKVQTLG 148
                  566899******************************************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.8E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.272161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.07E-32387IPR002100Transcription factor, MADS-box
PRINTSPR004045.8E-29323IPR002100Transcription factor, MADS-box
CDDcd002658.92E-43375No hitNo description
PfamPF003194.8E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004045.8E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004045.8E-293859IPR002100Transcription factor, MADS-box
PROSITE profilePS512979.23188172IPR002487Transcription factor, K-box
PfamPF014861.1E-1689148IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009909Biological Processregulation of flower development
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0009046anatomyflower
PO:0025022anatomycollective leaf structure
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MVRGKIEIKK IENVTSRQVT FSKRRSGLFK KAHELSVLCD AQVAAIVFSQ SGRLHEYSSS  60
QMEKIIDRYG KFSNAFYVAE RPQVERYLQE LKMEIDRMVK KIDLLEVHHR KLLGQGLDSC  120
SVTELQEIDT QIEKSLRIVR SRKVQTLGHK YIYNIYTHVN DVIMSSLVDL GA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-19173173Myocyte-specific enhancer factor 2B
1tqe_Q2e-19173173Myocyte-specific enhancer factor 2B
1tqe_R2e-19173173Myocyte-specific enhancer factor 2B
1tqe_S2e-19173173Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.296550.0seed
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible248374_at0.0
Expression AtlasAT5G51870-
AtGenExpressAT5G51870-
ATTED-IIAT5G51870-
Function -- GeneRIF ? help Back to Top
  1. Role for AGL71 in the floral transition in the apical and axillary meristems.
    [PMID: 21609362]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G51870.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G48150
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G51870
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1412200.0AY141220.1 Arabidopsis thaliana MADS-box protein AGL71 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_974924.11e-124MADS-box transcription factor AGL71
SwissprotQ9LT931e-101AGL71_ARATH; MADS-box protein AGL71
TrEMBLF4KEP81e-124F4KEP8_ARATH; Protein agamous-like 71
STRINGAT5G51870.36e-99(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  3. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  4. De Bodt S,Raes J,Van de Peer Y,Theissen G
    And then there were many: MADS goes genomic.
    Trends Plant Sci., 2003. 8(10): p. 475-83
    [PMID:14557044]
  5. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  6. Helliwell CA,Wood CC,Robertson M,James Peacock W,Dennis ES
    The Arabidopsis FLC protein interacts directly in vivo with SOC1 and FT chromatin and is part of a high-molecular-weight protein complex.
    Plant J., 2006. 46(2): p. 183-92
    [PMID:16623882]
  7. Dorca-Fornell C, et al.
    The Arabidopsis SOC1-like genes AGL42, AGL71 and AGL72 promote flowering in the shoot apical and axillary meristems.
    Plant J., 2011. 67(6): p. 1006-17
    [PMID:21609362]